PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0876s0005.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family EIL
Protein Properties Length: 585aa    MW: 66318.1 Da    PI: 5.0711
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0876s0005.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3435.83.9e-133384001350
                          XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasds 90 
                          e+l++rmwkd+++lkr+ker+k     + a   ++  +k+++qa+rkkmsraQDgiLkYMlk mevc+++GfvYgiipekgkpv+g+sd+
  Cagra.0876s0005.1.p  38 EDLERRMWKDRVRLKRIKERQKVGS--QGA-QTKEMPKKISDQAQRKKMSRAQDGILKYMLKLMEVCKVRGFVYGIIPEKGKPVSGSSDN 124
                          89*****************999754..444.5567789**************************************************** PP

                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HH CS
                 EIN3  91 LraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelw 180
                          +raWWkekv+fd+ngpaai+ky+ ++l++++++++    ++++  l++lqD+tlgSLLs+lmqhcdppqr+fplekg++pPWWPtG+e+w
  Cagra.0876s0005.1.p 125 IRAWWKEKVKFDKNGPAAIAKYEEECLAFGKSDGN----RNSQFVLQDLQDATLGSLLSSLMQHCDPPQRKFPLEKGTPPPWWPTGDEEW 210
                          *****************************987777....77999********************************************** PP

                          HHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX... CS
                 EIN3 181 wgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss... 265
                          w +lgl+k+q+ ppy+kphdlkk+wkv+vLtavi+hmsp+i++i++++rqsk+lqdkm+akes+++l+vlnqee+++++ s++  +s   
  Cagra.0876s0005.1.p 211 WVKLGLPKSQS-PPYRKPHDLKKMWKVGVLTAVINHMSPDIAKIKRHVRQSKCLQDKMTAKESAIWLAVLNQEESLIQQPSSDngNSnvt 299
                          ***********.9**********************************************************************6622688 PP

                          ...XXXX....XXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX..................XXXXXXXXXXXXXXXXXXXXX......X CS
                 EIN3 266 ...slrk....qspkvtlsceqkedvegkkeskikhvqavktta..................gfpvvrkrkkkpsesakvsskevsrtcq 330
                                +    +++k+++++++++dv+g+++ + + +++++++                   +++  r+rk+++ +s++v+ +       
  Cagra.0876s0005.1.p 300 ethR--RgnnaDRRKTVINSDSDYDVDGTEDASGSVSSKDSRRIqiqkepptaisqsvrdqdKAEKPRRRKRPRIRSETVNRQ------- 380
                          7540..33445888999**********77777766666666555788888888877555544555555565555555555544....... PP

                          XXXXXX.XXXXXXXXXXXXX CS
                 EIN3 331 ssqfrgsetelifadknsis 350
                          +++ +  e+++i++d+n+++
  Cagra.0876s0005.1.p 381 EEEQPLAEQRNILPDMNHVD 400
                          45555668899999999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.7E-12638283No hitNo description
Gene3DG3DSA:1.10.3180.102.5E-71159291IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.57E-60164286IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MGDLPMTVGD IRMENEPDDL ASDNVAEIDV SDEEIDAEDL ERRMWKDRVR LKRIKERQKV  60
GSQGAQTKEM PKKISDQAQR KKMSRAQDGI LKYMLKLMEV CKVRGFVYGI IPEKGKPVSG  120
SSDNIRAWWK EKVKFDKNGP AAIAKYEEEC LAFGKSDGNR NSQFVLQDLQ DATLGSLLSS  180
LMQHCDPPQR KFPLEKGTPP PWWPTGDEEW WVKLGLPKSQ SPPYRKPHDL KKMWKVGVLT  240
AVINHMSPDI AKIKRHVRQS KCLQDKMTAK ESAIWLAVLN QEESLIQQPS SDNGNSNVTE  300
THRRGNNADR RKTVINSDSD YDVDGTEDAS GSVSSKDSRR IQIQKEPPTA ISQSVRDQDK  360
AEKPRRRKRP RIRSETVNRQ EEEQPLAEQR NILPDMNHVD APLLDYNING THHEDVVVDP  420
NIALGPEEND LELVIPEFTN NYTYLPHVNG QTMMPVDERP MLYEPNPNQE LQFGSGYNFY  480
NPSAVFVHNQ EDDILHTQIE MNAQAPTHTS GFENQGGLLQ PHSLHGNEDG VRGSELPPQY  540
QSEQDKLLES NILSPFNDLT FDSSTLYSGL ESCAFDDDFS WFGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A4e-851632949140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1362370KPRRRKRPR
2363367PRRRK
3363369PRRRKRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0042150.0AF004215.1 Arabidopsis thaliana ethylene-insensitive3-like3 (EIL3) mRNA, complete cds.
GenBankAY0700440.0AY070044.1 Arabidopsis thaliana putative ethylene-insensitive protein EIL3 (At1g73730) mRNA, complete cds.
GenBankAY1338390.0AY133839.1 Arabidopsis thaliana clone U18784 putative ethylene-insensitive protein EIL3 (At1g73730) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302057.10.0hypothetical protein CARUB_v10020043mg
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLR0IA250.0R0IA25_9BRAS; Uncharacterized protein
STRINGBra015970.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46582548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.10.0ETHYLENE-INSENSITIVE3-like 3